Structure of PDB 6j6g Chain a Binding Site BS01

Receptor Information
>6j6g Chain a (length=84) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTLYVSQLNEKINMQRLRVNLFLLFATFGEVLKVSMNFKKQRGQAFITMR
TIDQASLAQISLNGERFFGKPLKVEFSKSETKTL
Ligand information
>6j6g Chain L (length=208) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acgaaucucuuugccuuuuggcuuagaucaaguguaguaucuguucuuuu
cauguaacaacuaaugaccucagaggcucaauuuguuacaauacacauuu
uuuggcacccaaaauaggacgggaagagacuuuuaaagugagacgucgcg
acccucgcaggagucguucuugacuuuuuggucgcuugauguuucucucu
ucccguuc
..................................................
..<<<<<<<<.....<.<<<<.>>>>.>....>>>>>>>>..........
.................<<<<<<<<<<.<<<<<.>>>>><<<<<<<<<<<
<.<<......<<<<<<....>>>>>>...>>>>>>..>>>>>>>>..>>>
>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j6g Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		F65 K66 K67 R69
Binding residue
(residue number reindexed from 1)		F38 K39 K40 R42
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0030620 U2 snRNA binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005686 U2 snRNP
GO:0071004 U2-type prespliceosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6j6g, PDBe:6j6g, PDBj:6j6g
PDBsum6j6g
PubMed30879786
UniProtP40567|MSL1_YEAST U2 small nuclear ribonucleoprotein B'' (Gene Name=MSL1)

[Back to BioLiP]