Structure of PDB 6j5a Chain a Binding Site BS01

Receptor Information

>6j5a Chain a (length=223) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NENLFASFIAPTMMGLPIVTLIIMFPSLLFPTPKRLINNRTISIQQWLIQ
LTSKQMMAIHNQKGQTWSLMLMSLIMFIGSTNILGLLPHSFTPTTQLSMN
LGMAIPLWSATVFTGFRYKTKTSLAHFLPQGTPALLIPMLVIIETISLFI
QPVALAVRLTANITAGHLLIHLIGGATLALLNINTMTAFITFTILILLTI
LEFAVALIQAYVFTLLVSLYLHD

Ligand information

>6j5a Chain d (length=24) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PFDQMTIEDLNEVFPETKLDKKKY

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6j5a Cryo-EM structure of the mammalian ATP synthase tetramer bound with inhibitory protein IF1.
Resolution	4.35 Å
Binding residue (original residue number in PDB)	L37 I38 M58
Binding residue (residue number reindexed from 1)	L36 I37 M57

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0015078	proton transmembrane transporter activity
GO:0046933	proton-transporting ATP synthase activity, rotational mechanism

	Biological Process
GO:0006754	ATP biosynthetic process
GO:0015986	proton motive force-driven ATP synthesis
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0045259	proton-transporting ATP synthase complex
GO:0045263	proton-transporting ATP synthase complex, coupling factor F(o)

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6j5a, PDBe:6j5a, PDBj:6j5a
PDBsum	6j5a
PubMed	31197009
UniProt	Q35915\|ATP6_PIG ATP synthase subunit a (Gene Name=MT-ATP6)

[Back to BioLiP]