Structure of PDB 6exn Chain a Binding Site BS01

Receptor Information
>6exn Chain a (length=171) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NRPERIQEAIAQDKTSVIIDPSQIGSTEGKPLLSMKCNLYIHEILSRWKA
SLEAYHPELFLDTKKALFPLLLQLRRNQLAPDLLISLATVLYHLQQPKEI
NLAVQSYMKLSIGNVAWPIGVTSVGIHARSAHSKIQGGRNAANIMIDERT
RLWITSIKRLITFEEWYTSNH
Ligand information
>6exn Chain I (length=39) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guaugucuaaaguuaugcucuuauuuacuaacaaacuag
.......................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6exn Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		I202 R205
Binding residue
(residue number reindexed from 1)		I126 R129
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000386 second spliceosomal transesterification activity
Biological Process
GO:0000350 generation of catalytic spliceosome for second transesterification step
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0071028 nuclear mRNA surveillance
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005682 U5 snRNP
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071021 U2-type post-spliceosomal complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6exn, PDBe:6exn, PDBj:6exn
PDBsum6exn
PubMed29146871
UniProtP33411|PRP18_YEAST Pre-mRNA-splicing factor 18 (Gene Name=PRP18)

[Back to BioLiP]