Structure of PDB 6b2z Chain a Binding Site BS01

Receptor Information

>6b2z Chain a (length=249) Species: 559292 (Saccharomyces cerevisiae S288C)

SPLDQFEIRTLFGLQSSFIDLSCLNLTTFSLYTIIVLLVITSLYTLTNNN
NKIIGSRWLISQEAIYDTIMNMTKGQIGGKNWGLYFPMIFTLFMFIFIAN
LISMIPYSFALSAHLVFIISLSIVIWLGNTILGLYKHGWVFFSLFVPAGT
PLPLVPLLVIIETLSYFARAISLGLRLGSNILAGHLLMVILAGLTFNFML
INLFTLVFGFVPLAMILAIMMLEFAIGIIQGYVWAILTASYLKDAVYLH

Ligand information

>6b2z Chain k (length=24) Species: 559292 (Saccharomyces cerevisiae S288C)

YHFMGKAIPPHQLAIGTLGLLGLL

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6b2z Atomic model for the dimeric FO region of mitochondrial ATP synthase.
• Resolution: 3.6 Å
• Binding residue (original residue number in PDB): L152 P156
• Binding residue (residue number reindexed from 1): L152 P156

Gene Ontology

Molecular Function

• GO:0015078 proton transmembrane transporter activity
• GO:0046933 proton-transporting ATP synthase activity, rotational mechanism

Biological Process

• GO:0006754 ATP biosynthetic process
• GO:0015986 proton motive force-driven ATP synthesis
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0045259 proton-transporting ATP synthase complex
• GO:0045263 proton-transporting ATP synthase complex, coupling factor F(o)

External links

• PDB: RCSB:6b2z, PDBe:6b2z, PDBj:6b2z
• PDBsum: 6b2z
• PubMed: 29074581
• UniProt: P00854|ATP6_YEAST ATP synthase subunit a (Gene Name=ATP6)