Structure of PDB 5mdx Chain a Binding Site BS01

Receptor Information
>5mdx Chain a (length=330) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI
DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGG
PYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLI
YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSL
FSAMHGSLVTSSLIRETTENESANEGYRFGQEEETYNIVAAHGYFGRLIF
QYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFNFNQSVVDSQ
GRVINTWADIINRANLGMEVMHERNAHNFP
Ligand information
>5mdx Chain t (length=29) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MEALVYTFLLVSTLGIIFFAIFFREPPKI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mdx Subunit and chlorophyll organization of the plant photosystem II supercomplex.
Resolution5.3 Å
Binding residue
(original residue number in PDB)		R27 R238 F239
Binding residue
(residue number reindexed from 1)		R17 R228 F229
Enzymatic activity
Enzyme Commision number 1.10.3.9: photosystem II.
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0009055 electron transfer activity
GO:0010242 oxygen evolving activity
GO:0016168 chlorophyll binding
GO:0016491 oxidoreductase activity
GO:0016682 oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0009635 response to herbicide
GO:0009772 photosynthetic electron transport in photosystem II
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
GO:0051238 sequestering of metal ion
Cellular Component
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009534 chloroplast thylakoid
GO:0009535 chloroplast thylakoid membrane
GO:0009536 plastid
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5mdx, PDBe:5mdx, PDBj:5mdx
PDBsum5mdx
PubMed28604725
UniProtP83755|PSBA_ARATH Photosystem II protein D1 (Gene Name=psbA)

[Back to BioLiP]