Structure of PDB 6gzx Chain Z2 Binding Site BS01

Receptor Information
>6gzx Chain Z2 (length=63) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFV
DTEGRVERFQRRY
Ligand information
>6gzx Chain B2 (length=122) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaucccccgugcccauagcggcguggaaccacccguucccauuccgaaca
cggaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccugg
gagaguaggucggugcggggga
...<<<<<<<.<.....<...<<..........<<...............
>>...........>>....><<<........<..<<<<....>>>>..>.
.......>>>..>.>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gzx Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.
Resolution4.57 Å
Binding residue
(original residue number in PDB)		M1 K2 E3
Binding residue
(residue number reindexed from 1)		M1 K2 E3
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gzx, PDBe:6gzx, PDBj:6gzx
PDBsum6gzx
PubMed30301898
UniProtQ5SJE1|RL31_THET8 Large ribosomal subunit protein bL31 (Gene Name=rpmE)

[Back to BioLiP]