Structure of PDB 8ixl Chain Z Binding Site BS01

Receptor Information
>8ixl Chain Z (length=46) Species: 1977402 (Inovirus M13) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS
Ligand information
>8ixl Chain IA (length=29) Species: 1977402 (Inovirus M13) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ADFDTIYQAMIQISVVLCFALGIIAGGQR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ixl Cryo-EM structure of a bacteriophage M13 mini variant.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		L14 A18 Y21
Binding residue
(residue number reindexed from 1)		L10 A14 Y17
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0016020 membrane
GO:0019029 helical viral capsid
GO:0020002 host cell plasma membrane

View graph for
Cellular Component
External links
PDB RCSB:8ixl, PDBe:8ixl, PDBj:8ixl
PDBsum8ixl
PubMed37669979
UniProtP69541|CAPSD_BPM13 Capsid protein G8P (Gene Name=VIII)

[Back to BioLiP]