Structure of PDB 8ez5 Chain Z Binding Site BS01

Receptor Information
>8ez5 Chain Z (length=62) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIAL
VLVVGVLNFFVV
Ligand information
>8ez5 Chain Y (length=27) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AQLTMIAMIGIAGPMIIFLLAVRRGNL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ez5 Structural evidence for intermediates during O 2 formation in photosystem II.
Resolution2.09 Å
Binding residue
(original residue number in PDB)		F17 I21 P24 A28 P30 Q31
Binding residue
(residue number reindexed from 1)		F17 I21 P24 A28 P30 Q31
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0015979 photosynthesis
GO:0042549 photosystem II stabilization
Cellular Component
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ez5, PDBe:8ez5, PDBj:8ez5
PDBsum8ez5
PubMed37138085
UniProtQ8DHJ2|PSBZ_THEVB Photosystem II reaction center protein Z (Gene Name=psbZ)

[Back to BioLiP]