Structure of PDB 7rf7 Chain Z Binding Site BS01

Receptor Information
>7rf7 Chain Z (length=62) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIAL
VLVVGVLNFFVV
Ligand information
>7rf7 Chain Y (length=27) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AQLTMIAMIGIAGPMIIFLLAVRRGNL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rf7 Structural dynamics in the water and proton channels of photosystem II during the S 2 to S 3 transition.
Resolution2.09 Å
Binding residue
(original residue number in PDB)		F17 A28 D32
Binding residue
(residue number reindexed from 1)		F17 A28 D32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0015979 photosynthesis
GO:0042549 photosystem II stabilization
Cellular Component
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7rf7, PDBe:7rf7, PDBj:7rf7
PDBsum7rf7
PubMed34764256
UniProtQ8DHJ2|PSBZ_THEVB Photosystem II reaction center protein Z (Gene Name=psbZ)

[Back to BioLiP]