Structure of PDB 7phr Chain Z Binding Site BS01

Receptor Information
>7phr Chain Z (length=34) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSFGLLDPKLCYLLDGILFIYGVILTALFLRVKF
Ligand information
>7phr Chain z (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LDPKLCYLLDGILFIYGVILTALFLRVKF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7phr Structure of a fully assembled tumor-specific T cell receptor ligated by pMHC.
Resolution3.08 Å
Binding residue
(original residue number in PDB)		C11 Y12 D15 L18 L25 T26 F29
Binding residue
(residue number reindexed from 1)		C11 Y12 D15 L18 L25 T26 F29
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7phr, PDBe:7phr, PDBj:7phr
PDBsum7phr
PubMed35985289
UniProtP20963|CD3Z_HUMAN T-cell surface glycoprotein CD3 zeta chain (Gene Name=CD247)

[Back to BioLiP]