Structure of PDB 7nkx Chain Z Binding Site BS01

Receptor Information
>7nkx Chain Z (length=156) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATIWGVRCRPGKEKELIRKLLKKKFNLDRAMGKKKLKILSIFQRDNYTGR
IYIEAPKQSVIEKFCNGVPDIYISQKLLIPVQELPLLLKPNLEEVALGKT
VRIRSAGYKGQLGIVKDVNGDKATVELHSKNKHITIDKHKLTYYNREGGE
GITYDE
Ligand information
>7nkx Chain N (length=128) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gtttttttctggagactagggagtaatccccttggcggttaaaacgcggg
ggacagcgcgtacgtgcgtttaagcggtgctagagctgtctacgaccaat
tgagcggcctcggcaccgggattctgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nkx Structural basis of nucleosome transcription mediated by Chd1 and FACT.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R293 P294
Binding residue
(residue number reindexed from 1)		R9 P10
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000993 RNA polymerase II complex binding
GO:0001042 RNA polymerase I core binding
GO:0001179 RNA polymerase I general transcription initiation factor binding
GO:0003677 DNA binding
GO:0003727 single-stranded RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0017070 U6 snRNA binding
GO:0019843 rRNA binding
GO:0030619 U1 snRNA binding
GO:0030620 U2 snRNA binding
GO:0030621 U4 snRNA binding
GO:0030623 U5 snRNA binding
GO:0042393 histone binding
GO:0044877 protein-containing complex binding
GO:0070990 snRNP binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0006338 chromatin remodeling
GO:0006354 DNA-templated transcription elongation
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006368 transcription elongation by RNA polymerase II
GO:0006397 mRNA processing
GO:0008298 intracellular mRNA localization
GO:0010508 positive regulation of autophagy
GO:0032784 regulation of DNA-templated transcription elongation
GO:0032968 positive regulation of transcription elongation by RNA polymerase II
GO:0090262 regulation of transcription-coupled nucleotide-excision repair
GO:0140673 transcription elongation-coupled chromatin remodeling
GO:2000232 regulation of rRNA processing
GO:2001208 negative regulation of transcription elongation by RNA polymerase I
GO:2001209 positive regulation of transcription elongation by RNA polymerase I
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005739 mitochondrion
GO:0032044 DSIF complex
GO:0032991 protein-containing complex
GO:0033553 rDNA heterochromatin
GO:0043232 intracellular non-membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nkx, PDBe:7nkx, PDBj:7nkx
PDBsum7nkx
PubMed33846633
UniProtP27692|SPT5_YEAST Transcription elongation factor SPT5 (Gene Name=SPT5)

[Back to BioLiP]