Structure of PDB 7kif Chain Z Binding Site BS01

Receptor Information
>7kif Chain Z (length=76) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QRLPVLPCHVGDPDLWFADTPAGLEVAKTLCVSCPIRRQCLAAALQRAEP
WGVWGGEIFDQGSIVSHKRPRGRPRK
Ligand information
>7kif Chain O (length=63) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggtcagaaaatcggttgtggtcagctgctgccaccggttaacctccaatt
ctgctgccagcct
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kif Structural basis of transcriptional activation by the Mycobacterium tuberculosis intrinsic antibiotic-resistance transcription factor WhiB7.
Resolution2.94 Å
Binding residue
(original residue number in PDB)		K80 R81 R85 P86
Binding residue
(residue number reindexed from 1)		K68 R69 R73 P74
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0035731 dinitrosyl-iron complex binding
GO:0046872 metal ion binding
GO:0047134 protein-disulfide reductase (NAD(P)H) activity
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045454 cell redox homeostasis
GO:0045892 negative regulation of DNA-templated transcription
GO:0046677 response to antibiotic
GO:0070542 response to fatty acid
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7kif, PDBe:7kif, PDBj:7kif
PDBsum7kif
PubMed34171296
UniProtQ6MX01|WHB7A_MYCTU Probable transcriptional regulator WhiB7 (Gene Name=whiB7)

[Back to BioLiP]