Structure of PDB 6eu0 Chain Z Binding Site BS01

Receptor Information
>6eu0 Chain Z (length=339) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPVCKNCHGTEFERDLSNANNDLVCKACGVVSEDNPIVSSREATLNNARR
KLRAVSYALHIPEYITDAAFQWYKLALANNFVQGRRSQNVIASCLYVACR
KEKTHHMLIDFSSRLQVSVYSIGATFLKMVKKLHITELPLADPSLFIQHF
AEKLDLADKKIKVVKDAVKLAQRMSKDWMFEGRRPAGIAGACILLACRMN
NLRRTHTEIVAVSHVAEETLQQRLNEFKNTKAAKLSVQKFRENDVEDGEA
RPPSFVKNRKKERKIPRNLHLLPTTDTYLSKVSDDPDNLEDVDDEELNAH
LLNEEASKLKERIWIGLNADFLLEQESKRLKQEADIATG
Ligand information
>6eu0 Chain R (length=51) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ttttcggctactataaaaaaatgtttttttcgttcgcgaagtaacccttc
g
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6eu0 Structural basis of RNA polymerase III transcription initiation.
Resolution4.0 Å
Binding residue
(original residue number in PDB)		T79 G119 R120 Y155 N260
Binding residue
(residue number reindexed from 1)		T44 G84 R85 Y120 N225
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000994 RNA polymerase III core binding
GO:0000995 RNA polymerase III general transcription initiation factor activity
GO:0001006 RNA polymerase III type 3 promoter sequence-specific DNA binding
GO:0001156 TFIIIC-class transcription factor complex binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0017025 TBP-class protein binding
GO:0046872 metal ion binding
Biological Process
GO:0001112 DNA-templated transcription open complex formation
GO:0006352 DNA-templated transcription initiation
GO:0006359 regulation of transcription by RNA polymerase III
GO:0006383 transcription by RNA polymerase III
GO:0070897 transcription preinitiation complex assembly
GO:0070898 RNA polymerase III preinitiation complex assembly
Cellular Component
GO:0000126 transcription factor TFIIIB complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0097550 transcription preinitiation complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6eu0, PDBe:6eu0, PDBj:6eu0
PDBsum6eu0
PubMed29345637
UniProtP29056|TF3B_YEAST Transcription factor IIIB 70 kDa subunit (Gene Name=BRF1)

[Back to BioLiP]