Structure of PDB 4gop Chain Z Binding Site BS01

Receptor Information

>4gop Chain Z (length=433) Species: 237631 ()

IYPIEGLSPYQNRWTIKARVTSKSDIRHWSNQRGEGKLFSVNLLDDSGEI
KATGFNDAVDRFYPLLQENHVYLISKARVNIAKKQFSNLQNEYEITFENS
TEIEECTDATDVPEVKYEFVRINELESVEANQQCDVIGILDSYGELSEIV
SKASQRPVQKRELTLVDQGNRSVKLTLWGKTAETFPTNAGVDEKPVLAFK
GVKVGDFGGRSLSMFSSSTMLINPDITESHVLRGWYDNDGAHAQFQPYTN
GGGAGANMAERRTIVQVKDENLGMSEKPDYFNVRATVVYIKQENLYYTAC
ASEGCNKKVNLDHENNWRCEKCDRSYATPEYRYILSTNVADATGQMWLSG
FNEDATQLIGMSAGELHKLREESESEFSAALHRAANRMYMFNCRAKMDTF
NDTARVRYTISRAAPVDFAKAGMELVDAIRAYM

Ligand information

>4gop Chain L (length=20)

tttttttttttttttttttt

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4gop Structure and conformational change of a replication protein A heterotrimer bound to ssDNA.
• Resolution: 3.1 Å
• Binding residue (original residue number in PDB): R208 W210 F236 R259 K264 F267 K333 V339 W359 K384 F388 F396 S397 G443 A444 G445 A446 N447 M448 Y470 V478 Y479 K481 Y487 N496 K498 K511 R522 W537 F541 D588 F590 R595 R597
• Binding residue (residue number reindexed from 1): R27 W29 F55 R78 K83 F86 K152 V158 W178 K203 F207 F215 S216 G253 A254 G255 A256 N257 M258 Y280 V288 Y289 K291 Y297 N306 K308 K321 R332 W347 F351 D398 F400 R405 R407

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Nov 17 17:34:12 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4gop', asym_id = 'Z', bs = 'BS01', title = 'Structure and conformational change of a replication protein A heterotrimer bound to ssDNA.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4gop', asym_id='Z', bs='BS01', title='Structure and conformational change of a replication protein A heterotrimer bound to ssDNA.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003676,0003677,0005634,0006260,0006281,0006310', uniprot = '', pdbid = '4gop', asym_id = 'Z'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0003677,0005634,0006260,0006281,0006310', uniprot='', pdbid='4gop', asym_id='Z')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>