Structure of PDB 3zbi Chain Z Binding Site BS01

Receptor Information
>3zbi Chain Z (length=130) Species: 511693 (Escherichia coli BL21) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AADKKRITQKLKQTAFAGAKNYQYVMSEQPEMRSIQPVHVWDNYRFTRFE
FPANAELPQVYMISASGKETLPNSHVVGENRNIIEVETVAKEWRIRLGDK
VVGVRNNNFAPGRGAVATGTASPDVRRVQI
Ligand information
>3zbi Chain a (length=28) Species: 511693 (Escherichia coli BL21) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
CSSGHKPPPEPDWSNTVPVNKTIPVDTQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3zbi Structure of a Bacterial Type Iv Secretion Core Complex at Subnanometre Resolution.
Resolution8.5 Å
Binding residue
(original residue number in PDB)		Q917 F920 Y928 V929 M930 S931 E932 Q933 H943 V944 W945 R952 V981 E983 N984 E996 R998 R1000 V1005 R1009
Binding residue
(residue number reindexed from 1)		Q13 F16 Y24 V25 M26 S27 E28 Q29 H39 V40 W41 R48 V77 E79 N80 E92 R94 R96 V101 R105
Enzymatic activity
Enzyme Commision number ?
External links