Structure of PDB 2xb2 Chain Z Binding Site BS01

Receptor Information
>2xb2 Chain Z (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKG
YTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xb2 Insights Into the Recruitment of the Nmd Machinery from the Crystal Structure of a Core Ejc-Upf3B Complex.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		E82 R109 T110 Y112
Binding residue
(residue number reindexed from 1)		E17 R44 T45 Y47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
Biological Process
GO:0006396 RNA processing
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2xb2, PDBe:2xb2, PDBj:2xb2
PDBsum2xb2
PubMed20479275
UniProtQ9Y5S9|RBM8A_HUMAN RNA-binding protein 8A (Gene Name=RBM8A)

[Back to BioLiP]