Structure of PDB 6of6 Chain YZ Binding Site BS01

Receptor Information
>6of6 Chain YZ (length=183) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEYRLKAYYREGEKPSALRRAGKLPGVMYNRHLNRKVYVDLVEFDKVFRQ
ASIHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYV
PLRFVGTPAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSL
HASDLKLPPGVELAVSPEETIAAVVPPEDVEKL
Ligand information
>6of6 Chain XY (length=75) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggggcuauagcucagcugggagagcgcuugcauggcaugcaagaggucag
cgguucgaucccgcuuagcuccacc
.<<<<<...<<<<........>>>>.<<<<<<.....>>>>>>.....<<
<<.........>>>>.>>.>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6of6 Disruption of evolutionarily correlated tRNA elements impairs accurate decoding.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		P176 P177 E178 D179 V180 E181 K182 L183
Binding residue
(residue number reindexed from 1)		P176 P177 E178 D179 V180 E181 K182 L183
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6of6, PDBe:6of6, PDBj:6of6
PDBsum6of6
PubMed32601241
UniProtQ5SHZ1|RL25_THET8 Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]