Structure of PDB 8y6o Chain Y Binding Site BS01

Receptor Information

>8y6o Chain Y (length=229) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MEGEPPPVEERRRLQEELNEFVESGCRTLEEVTASLGWDLDSLDPGAEDE
VVICPYDSNHHMPKSSLAKHMASCRLRKMGYTKEEEDEMYNPEFFYENVK
IPSITLNKDSQFQIIKQARTAVGKDSDCYNQRIYSSLPVEVPLNHKRFVC
DLTQADRLALYDFVVEETKKKRSDSQIIEEVRDYKRRRQSYRAKNVHITK
KSYTEVIRDVINVHMEELSNHWQEEQEKA

Ligand information

>8y6o Chain A (length=13) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaauauccuuuuc

.............

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8y6o Structural basis of U12-type intron engagement by the fully assembled human minor spliceosome
Resolution	3.38 Å
Binding residue (original residue number in PDB)	K219 R220 R222 Y225
Binding residue (residue number reindexed from 1)	K185 R186 R188 Y191

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0046872	metal ion binding

	Biological Process
GO:0006397	mRNA processing
GO:0008380	RNA splicing

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005681	spliceosomal complex
GO:0005689	U12-type spliceosomal complex
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8y6o, PDBe:8y6o, PDBj:8y6o
PDBsum	8y6o
PubMed	38484052
UniProt	Q6IEG0\|SNR48_HUMAN U11/U12 small nuclear ribonucleoprotein 48 kDa protein (Gene Name=SNRNP48)

[Back to BioLiP]