Structure of PDB 8p2f Chain Y Binding Site BS01

Receptor Information
>8p2f Chain Y (length=94) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLKSIIRQGKQTRSDLKQLRKSGKVPAVVYGYGTKNVSVKVDEVEFIKVI
REVGRNGVIELGVGSKTIKVMVADYQFDPLKNQITHIDFLAINM
Ligand information
>8p2f Chain B (length=113) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cuggugacuauagcaaggaggucacaccuguucccaugccgaacacagaa
guuaagcuccuuagcgucgaugguagucgaacuuacguuccgcuagagua
gaacguugccagg
<<<<<<<<....<<<<<<<<.....<<<<<...............>>>..
>>....>>>>>>.>>.<<......<<<.<<<<....>>>>.>>>......
>>..>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8p2f Cryo-EM structures of Staphylococcus aureus 70S ribosomes in complex with elongation factor G and fusidic acid
Resolution2.44 Å
Binding residue
(original residue number in PDB)		T14 R15 S16 L18 R22 V30 Y32 N38 S40 Q78 H88
Binding residue
(residue number reindexed from 1)		T12 R13 S14 L16 R20 V28 Y30 N36 S38 Q76 H86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8p2f, PDBe:8p2f, PDBj:8p2f
PDBsum8p2f
PubMed38902339
UniProtQ2G0S0

[Back to BioLiP]