Structure of PDB 8ovj Chain Y Binding Site BS01

Receptor Information

>8ovj Chain Y (length=132) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KFLKPGKVVIVTAGRYAGHKAVIVQNSDVVTKERPYGRALLAGIKKYPKK
VVRGMSKQTIARRSQVGVFLRVVNHKHFLPTRYNVDMSKELRGKINVSDA
SKRSRSKRLVRHVFQARYNAGSSMWFFQRLRF

Ligand information

>8ovj Chain 3 (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gugguaaugcggccagguaacaaaucaauccucccacggugagcuuucuu
uucaccauaauccaccuugggccuuuuuacucucgcguuguucggagcgg
gggcucaagauugaaaaaugcauugugaguucugcgcuaaagcaaaaacc
uggggu

<<<....>>>..<<<<<<.......<<...<<<.<<.<<<<<<.......
>>>>>><...<<.<.<<<<<<<<<<<.......<<.......>>....>>
>>>>>>>>>.>.>>....>....>>.>>>...>>.............>>>
>>>...

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
Resolution	2.4 Å
Binding residue (original residue number in PDB)	G16 R17 R36 Y38 K47 R73 V74 N76 K78 H79
Binding residue (residue number reindexed from 1)	G14 R15 R34 Y36 K45 R71 V72 N74 K76 H77

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ovj, PDBe:8ovj, PDBj:8ovj
PDBsum	8ovj
PubMed	38722744
UniProt	Q4Q504

[Back to BioLiP]