Structure of PDB 8ixl Chain Y Binding Site BS01

Receptor Information
>8ixl Chain Y (length=32) Species: 1977402 (Inovirus M13) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSVLVYSFASFVLGWCLRSGITYFTRLMETSS
Ligand information
>8ixl Chain S (length=29) Species: 1977402 (Inovirus M13) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ADFDTIYQAMIQISVVLCFALGIIAGGQR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ixl Cryo-EM structure of a bacteriophage M13 mini variant.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		S7 S10 F11 G14 W15 R18 T22 R26 E29
Binding residue
(residue number reindexed from 1)		S7 S10 F11 G14 W15 R18 T22 R26 E29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0016020 membrane
GO:0033644 host cell membrane
GO:0044423 virion component

View graph for
Cellular Component
External links
PDB RCSB:8ixl, PDBe:8ixl, PDBj:8ixl
PDBsum8ixl
PubMed37669979
UniProtP69538|G9P_BPM13 Tail virion protein G9P (Gene Name=IX)

[Back to BioLiP]