Structure of PDB 8i0w Chain Y Binding Site BS01

Receptor Information

>8i0w Chain Y (length=204) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SERKVLNKYYPPDFDPSKIPKLKLPKDRQYVVRLMAPFNMRCKTCGEYIY
KGKKFNARKETVQNEVYLGLPIFRFYIKCTRCLAEITFKTDPENTDYTME
HGATRNFQAEKLLEEEEKRVQKEREDEELNNPMKVLENRTKDSKLEMEVL
ENLQELKDLNQRQAHVDFEAMLRQHRLSEEERRRQQQEEDEQETAALLEE
ARKR

Ligand information

>8i0w Chain F (length=97) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gugcucgcuucggcagcacauauacuaaaauuggaacgauacagagaaga
uuagcauggccccugcgcaaggaugacacgcaaauucgugaagcguu

<<<<<.<<<..>>>>>>>>...............................
......<<...<<<.....>>>....>>...................

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8i0w Molecular basis for the activation of human spliceosome
Resolution	3.4 Å
Binding residue (original residue number in PDB)	R34 Y51 G53 K54 K55 N57 K79
Binding residue (residue number reindexed from 1)	R33 Y50 G52 K53 K54 N56 K78

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0046872	metal ion binding

	Biological Process
GO:0000349	generation of catalytic spliceosome for first transesterification step
GO:0006397	mRNA processing
GO:0008380	RNA splicing
GO:0043518	negative regulation of DNA damage response, signal transduction by p53 class mediator

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005681	spliceosomal complex
GO:0071006	U2-type catalytic step 1 spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8i0w, PDBe:8i0w, PDBj:8i0w
PDBsum	8i0w
PubMed	39068178
UniProt	Q9BW85\|YJU2_HUMAN Splicing factor YJU2 (Gene Name=YJU2)

[Back to BioLiP]