Structure of PDB 8i0w Chain Y Binding Site BS01

Receptor Information
>8i0w Chain Y (length=204) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SERKVLNKYYPPDFDPSKIPKLKLPKDRQYVVRLMAPFNMRCKTCGEYIY
KGKKFNARKETVQNEVYLGLPIFRFYIKCTRCLAEITFKTDPENTDYTME
HGATRNFQAEKLLEEEEKRVQKEREDEELNNPMKVLENRTKDSKLEMEVL
ENLQELKDLNQRQAHVDFEAMLRQHRLSEEERRRQQQEEDEQETAALLEE
ARKR
Ligand information
>8i0w Chain F (length=97) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugcucgcuucggcagcacauauacuaaaauuggaacgauacagagaaga
uuagcauggccccugcgcaaggaugacacgcaaauucgugaagcguu
<<<<<.<<<..>>>>>>>>...............................
......<<...<<<.....>>>....>>...................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8i0w Molecular basis for the activation of human spliceosome
Resolution3.4 Å
Binding residue
(original residue number in PDB)
R34 Y51 G53 K54 K55 N57 K79
Binding residue
(residue number reindexed from 1)
R33 Y50 G52 K53 K54 N56 K78
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0046872 metal ion binding
Biological Process
GO:0000349 generation of catalytic spliceosome for first transesterification step
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0043518 negative regulation of DNA damage response, signal transduction by p53 class mediator
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0071006 U2-type catalytic step 1 spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8i0w, PDBe:8i0w, PDBj:8i0w
PDBsum8i0w
PubMed39068178
UniProtQ9BW85|YJU2_HUMAN Splicing factor YJU2 (Gene Name=YJU2)

[Back to BioLiP]