Structure of PDB 8a3l Chain Y Binding Site BS01

Receptor Information
>8a3l Chain Y (length=172) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FAQLFEESLKEIETRPGSIVRGVVVAIDKDVVLVDAGLKSESAIPAEQFK
NAQGELEIQVGDEVDVALDAVEDGFGETLLSREKAKRHEAWITLEKAYED
AETVTGVINGKVKGGFTVELNGIRAFLPGSLVDVRPVRDTLHLEGKELEF
KVIKLDQKRNNVVVSRRAVIES
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8a3l Structural insights into the binding of bS1 to the ribosome.
Resolution3.42 Å
Binding residue
(original residue number in PDB)		K117 G118 F120
Binding residue
(residue number reindexed from 1)		K113 G114 F116
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003727 single-stranded RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0010501 RNA secondary structure unwinding
GO:2000766 negative regulation of cytoplasmic translation
GO:2000767 positive regulation of cytoplasmic translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0016020 membrane
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8a3l, PDBe:8a3l, PDBj:8a3l
PDBsum8a3l
PubMed36840711
UniProtP0AG67|RS1_ECOLI Small ribosomal subunit protein bS1 (Gene Name=rpsA)

[Back to BioLiP]