Structure of PDB 7dvq Chain Y Binding Site BS01

Receptor Information
>7dvq Chain Y (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNPLTKVKLINELNEREVQLGVADKVSWHSEYKDSAWIFLGGLPYELTEG
DIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTILAVDNFNGI
KIKGRTIRVDHVSNYRAPKDSEEIDDVTRQLQEKGCGART
Ligand information
>7dvq Chain G (length=63) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucggccuccgaaauauccuuuucuagcaugugucauauccuuaacucauu
gucccuuuuuuuu
..................................................
.............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dvq Structure of the activated human minor spliceosome.
Resolution2.89 Å
Binding residue
(original residue number in PDB)		N2 P3 L4 T5 F39 G42 L43 Y45 F79 R105 T106 Y115 R116 A117 P118 K119
Binding residue
(residue number reindexed from 1)		N2 P3 L4 T5 F39 G42 L43 Y45 F79 R105 T106 Y115 R116 A117 P118 K119
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005686 U2 snRNP
GO:0005730 nucleolus
GO:0005783 endoplasmic reticulum
GO:0031965 nuclear membrane
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7dvq, PDBe:7dvq, PDBj:7dvq
PDBsum7dvq
PubMed33509932
UniProtQ9Y388|RBMX2_HUMAN RNA-binding motif protein, X-linked 2 (Gene Name=RBMX2)

[Back to BioLiP]