Structure of PDB 7c06 Chain Y Binding Site BS01

Receptor Information
>7c06 Chain Y (length=179) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VNCSFYYKIGACRHGERCSRKHVKPNFSQTILCPNMYKNPIHEPNGKKFT
QRELAEQFDAFYEDMFCEFSKYGEVEQLVVCDNVGDHLVGNVYVRFKYEE
SAQNAIDDLNSRWYSQRPVYAELSPVTDFREACCRQHETSECQRGGLCNF
MHAKKPSPQLLRDLVLAQRKYLALNAAEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7c06 Elucidation of the aberrant 3' splice site selection by cancer-associated mutations on the U2AF1.
Resolution3.02 Å
Binding residue
(original residue number in PDB)
S19 F20 K23 R28 H29 C33 S34 R35 E146 C148 C149 R150 Q151 R159 C163 N164 F165
Binding residue
(residue number reindexed from 1)
S4 F5 K8 R13 H14 C18 S19 R20 E131 C133 C134 R135 Q136 R144 C148 N149 F150
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030628 pre-mRNA 3'-splice site binding
GO:0046872 metal ion binding
Biological Process
GO:0000389 mRNA 3'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
Cellular Component
GO:0000243 commitment complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005829 cytosol
GO:0071004 U2-type prespliceosome
GO:0089701 U2AF complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7c06, PDBe:7c06, PDBj:7c06
PDBsum7c06
PubMed32958768
UniProtQ09176|U2AF1_SCHPO Splicing factor U2AF 23 kDa subunit (Gene Name=SPAP8A3.06)

[Back to BioLiP]