Structure of PDB 6xkw Chain Y Binding Site BS01

Receptor Information
>6xkw Chain Y (length=30) Species: 272942 (Rhodobacter capsulatus SB 1003) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLVKTHITKIGVTLFAVALFYGFIYMLSNS
Ligand information
>6xkw Chain h (length=25) Species: 272942 (Rhodobacter capsulatus SB 1003) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LLMFVAFFGLIIAVNVTMAVQAVKT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xkw Cryo-EM structures of engineered active bc 1 -cbb 3 type CIII 2 CIV super-complexes and electronic communication between the complexes.
Resolution5.2 Å
Binding residue
(original residue number in PDB)		I7 T8 G11 V12 F15 A16 L19 F20 F23 L27
Binding residue
(residue number reindexed from 1)		I7 T8 G11 V12 F15 A16 L19 F20 F23 L27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0005886 plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6xkw, PDBe:6xkw, PDBj:6xkw
PDBsum6xkw
PubMed33568648
UniProtQ05389|CYCY_RHOCB Cytochrome c-type cyt cy (Gene Name=cycY)

[Back to BioLiP]