Structure of PDB 5zwn Chain Y Binding Site BS01

Receptor Information
>5zwn Chain Y (length=196) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSTPAAEQRKLVEQLMGPKICKSYLVGECPYDLFQGTKQSLGKCPQMHLT
KHKIQYEREVKQGKTFPEFEREYLAILSRFVNECNGQISVALQNLKHTAE
ERMKIQQVTEELDVLDVRIGLMKLQELISKRKEVAKRVRNITENVGQSAQ
QKLQVCEVCGAYLSRLDTDRRLADHFLGKIHLGYVKMREDYDRLMK
Ligand information
>5zwn Chain G (length=22) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaaaaaaaaagguauguauuaa
......................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zwn Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
Resolution3.4 Å
Binding residue
(original residue number in PDB)		D212 R216
Binding residue
(residue number reindexed from 1)		D167 R171
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0008270 zinc ion binding
Biological Process
GO:0000395 mRNA 5'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
GO:0006376 mRNA splice site recognition
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0000243 commitment complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005685 U1 snRNP
GO:0005829 cytosol
GO:0071004 U2-type prespliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5zwn, PDBe:5zwn, PDBj:5zwn
PDBsum5zwn
PubMed29794219
UniProtQ07508|LUC7_YEAST Protein LUC7 (Gene Name=LUC7)

[Back to BioLiP]