Structure of PDB 5yzg Chain Y Binding Site BS01

Receptor Information
>5yzg Chain Y (length=204) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SERKVLNKYYPPDFDPSKIPKLKLPKDRQYVVRLMAPFNMRCKTCGEYIY
KGKKFNARKETVQNEVYLGLPIFRFYIKCTRCLAEITFKTDPENTDYTME
HGATRNFQAEKLLEEEEKRVQKEREDEELNNPMKVLENRTKDSKLEMEVL
ENLQELKDLNQRQAHVDFEAMLRQHRLSEEERRRQQQEEDEQETAALLEE
ARKR
Ligand information
>5yzg Chain F (length=97) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugcucgcuucggcagcacauauacuaaaauuggaacgauacagagaaga
uuagcauggccccugcgcaaggaugacacgcaaauucgugaagcguu
<<<<<.<<<..>>>>>>>>...............................
......<<...<<<.....>>>....>>...................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yzg Structure of a human catalytic step I spliceosome
Resolution4.1 Å
Binding residue
(original residue number in PDB)		R34 M36 Y51 K54 K55 N57 K79
Binding residue
(residue number reindexed from 1)		R33 M35 Y50 K53 K54 N56 K78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0046872 metal ion binding
Biological Process
GO:0000349 generation of catalytic spliceosome for first transesterification step
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0043518 negative regulation of DNA damage response, signal transduction by p53 class mediator
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0071006 U2-type catalytic step 1 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5yzg, PDBe:5yzg, PDBj:5yzg
PDBsum5yzg
PubMed29301961
UniProtQ9BW85|YJU2_HUMAN Splicing factor YJU2 (Gene Name=YJU2)

[Back to BioLiP]