Structure of PDB 5mq0 Chain Y Binding Site BS01

Receptor Information
>5mq0 Chain Y (length=84) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTLYVSQLNEKINMQRLRVNLFLLFATFGEVLKVSMNFKKQRGQAFITMR
TIDQASLAQISLNGERFFGKPLKVEFSKSETKTL
Ligand information
>5mq0 Chain 2 (length=155) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acgaaucucuuugccuuuuggcuuagaucaaguguaguaucuguucuuug
uaacaacugaaaugaccuaggcucauuguuacggacgggaagaggagacg
ucgcgacccucgcagucguucuugacuggucgcuugauguuucuucuucc
cguuc
.................................................<
<<<<<<......<<<<<<>>>.>>>>>>>>>><<<<<<<<<<<.<<<<<<
<<<<<<.<<.....<<<<....>>>>.>>>>>>..>>>>>>>>.>>>>>>
>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mq0 Structure of a spliceosome remodelled for exon ligation.
Resolution4.17 Å
Binding residue
(original residue number in PDB)		Y31 M41 Q68 R69 F73 S104 T108
Binding residue
(residue number reindexed from 1)		Y4 M14 Q41 R42 F46 S77 T81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0030620 U2 snRNA binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005686 U2 snRNP
GO:0071004 U2-type prespliceosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5mq0, PDBe:5mq0, PDBj:5mq0
PDBsum5mq0
PubMed28076345
UniProtP40567|MSL1_YEAST U2 small nuclear ribonucleoprotein B'' (Gene Name=MSL1)

[Back to BioLiP]