Structure of PDB 5lqw Chain Y Binding Site BS01

Receptor Information
>5lqw Chain Y (length=89) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FDLIMCLKQPGVQTGLLCEKCDGKCPICDSYVRPKRKVRVCENCSFGKQA
KNCIICNNVGVNDAFYCWECCRLGKDKDGCPRILNLGSN
Ligand information
>5lqw Chain 9 (length=54) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cugaauuaacaauggauucugguauguucuguacuaacaucgauugcuuc
auuc
..................................................
....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lqw Molecular architecture of the Saccharomyces cerevisiae activated spliceosome
Resolution5.8 Å
Binding residue
(original residue number in PDB)		N64 V65
Binding residue
(residue number reindexed from 1)		N58 V59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0009410 response to xenobiotic stimulus
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005686 U2 snRNP
GO:0071011 precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5lqw, PDBe:5lqw, PDBj:5lqw
PDBsum5lqw
PubMed27562955
UniProtQ06835|RDS3_YEAST Pre-mRNA-splicing factor RDS3 (Gene Name=RDS3)

[Back to BioLiP]