Structure of PDB 5lj5 Chain Y Binding Site BS01

Receptor Information
>5lj5 Chain Y (length=84) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTLYVSQLNEKINMQRLRVNLFLLFATFGEVLKVSMNFKKQRGQAFITMR
TIDQASLAQISLNGERFFGKPLKVEFSKSETKTL
Ligand information
>5lj5 Chain Z (length=171) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaaucucuuugccuuuuggcuuagaucaaguguaguaucuguucuuguaa
caacugaaaugaccuaggcucauuguuacaauacacauuuuuuggggacg
ggaagaggagacgucgcgacccucgcagagucguucuugacuuggucgcu
ugauguuucuucuucccguuc
.............................................<<<<<
<<<......<<<<<<>>>.>>>>>>>>>>>...............<<<<<
<<<<<<.<<<<<<<<<<<<.<<.....<<<<<<....>>>>>>>>>>>>.
.>>>>>>>>.>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lj5 Cryo-EM structure of the spliceosome immediately after branching.
Resolution10.0 Å
Binding residue
(original residue number in PDB)		Y31 E37 M41
Binding residue
(residue number reindexed from 1)		Y4 E10 M14
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0030620 U2 snRNA binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005686 U2 snRNP
GO:0071004 U2-type prespliceosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5lj5, PDBe:5lj5, PDBj:5lj5
PDBsum5lj5
PubMed27459055
UniProtP40567|MSL1_YEAST U2 small nuclear ribonucleoprotein B'' (Gene Name=MSL1)

[Back to BioLiP]