Structure of PDB 4qqb Chain Y Binding Site BS01

Receptor Information
>4qqb Chain Y (length=72) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAMATRETGIIEKLLHSYGFIQCCERQARLFFHFSQFSGNIDHLKIGDPV
EFEMTYDRRTGKPIASQVSKIA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qqb Structural basis for the assembly of the Sxl-Unr translation regulatory complex.
Resolution2.8 Å
Binding residue
(original residue number in PDB)
K13 L15 H16 S17 Y18 F20 R29 F31 H33 K62
Binding residue
(residue number reindexed from 1)
K13 L15 H16 S17 Y18 F20 R29 F31 H33 K62
Binding affinityPDBbind-CN: Kd=1.24nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:4qqb, PDBe:4qqb, PDBj:4qqb
PDBsum4qqb
PubMed25209665
UniProtB7Z0E2|UNR_DROME RNA-binding protein Unr (Gene Name=Unr)

[Back to BioLiP]