Structure of PDB 2hld Chain Y Binding Site BS01

Receptor Information
>2hld Chain Y (length=200) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATLKEVEMRLKSIKNIEKITKTMKIVASTRLSKAEKAKISAKKMDITSDK
GLCGSIHSQLAKAVRRHLNDQPNAVTIGDKIKMQLLRTHPNINGIGKDAP
TFQESALIADKLLSVMKAISIFYNDPVSSLSFEPSEYTLANQMLTAMAQG
YAAEISARRNAMDNASKNAGDMINRYSILYNRTRQAVITNELVDIITGAS
Ligand information
>2hld Chain 1 (length=27) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SYAAYLNVAAQAIRSVLNRSQTDAFYT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hld Novel features of the rotary catalytic mechanism revealed in the structure of yeast F(1) ATPase.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		N131 Q141 D148 E211
Binding residue
(residue number reindexed from 1)		N93 Q103 D110 E136
Enzymatic activity
Enzyme Commision number 3.6.3.14: Transferred entry: 7.1.2.2.
Gene Ontology
Molecular Function
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Biological Process
GO:0015986 proton motive force-driven ATP synthesis
Cellular Component
GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1)

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2hld, PDBe:2hld, PDBj:2hld
PDBsum2hld
PubMed17082766
UniProtP38077|ATPG_YEAST ATP synthase subunit gamma, mitochondrial (Gene Name=ATP3)

[Back to BioLiP]