Structure of PDB 2c9l Chain Y Binding Site BS01

Receptor Information
>2c9l Chain Y (length=63) Species: 10376 (human gammaherpesvirus 4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLEIKRYKNRVAARKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCP
SLDVDSIIPRTPD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2c9l Structural Basis of Lytic Cycle Activation by the Epstein-Barr Virus Zebra Protein
Resolution2.25 Å
Binding residue
(original residue number in PDB)		R179 N182 R183 R187 R190
Binding residue
(residue number reindexed from 1)		R6 N9 R10 R14 R17
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2c9l, PDBe:2c9l, PDBj:2c9l
PDBsum2c9l
PubMed16483937
UniProtP03206|BZLF1_EBVB9 Lytic switch protein BZLF1 (Gene Name=BZLF1)

[Back to BioLiP]