Structure of PDB 8apo Chain Xa Binding Site BS01

Receptor Information
>8apo Chain Xa (length=199) Species: 353565 (Polytomella magna) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IEEYYVVPPACPPPPHNPKTLKYVPKLNRTQIIARVYEAKTPTELENSAL
GKKFFSEFAAVAKLVRLSQLRRANVYNSRDDAMCVSIYNTSVRVADKLLH
LSSDEELCGLIWALSQLPYPEYENLVDRSLQILLEEDKPLKTGSSLAVSR
AAAGLASLGRWDASTWEVLVPLLRKNVQEGKEVELSNLALGLYDARETV
Ligand information
>8apo Chain A9 (length=69) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uaaugcgauaauacgcaugacgguucauuuuugccguguguggucacggu
aaaacuuaagaaucgucca
...<<<<......>>>>..<<<<<<<.....<<<<<<<......>>>>>>
...>.....>>>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8apo Structure of the mitochondrial ribosome from Polytomella magna with tRNAs bound to the A and P sites
Resolution3.2 Å
Binding residue
(original residue number in PDB)		K71 T72 V76 K78 E98 N99 L102 K104 K105 F106 M135 S138 R145 K149
Binding residue
(residue number reindexed from 1)		K19 T20 V24 K26 E46 N47 L50 K52 K53 F54 M83 S86 R93 K97
External links