Structure of PDB 8qzs Chain X Binding Site BS01

Receptor Information
>8qzs Chain X (length=80) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSL
DKAKEEEKASKEFAAMEAAALKAYQEDLKR
Ligand information
>8qzs Chain 6 (length=59) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acgauacagagaagauuagcauggccccugcgcaaggaugacauucguga
agcguauuu
..................................................
.........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qzs Structural insights into the cross-exon to cross-intron spliceosome switch
Resolution4.1 Å
Binding residue
(original residue number in PDB)		W5 K6 S7 Q8
Binding residue
(residue number reindexed from 1)		W3 K4 S5 Q6
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0046872 metal ion binding
GO:0070064 proline-rich region binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0016607 nuclear speck
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qzs, PDBe:8qzs, PDBj:8qzs
PDBsum8qzs
PubMed38778104
UniProtO75554|WBP4_HUMAN WW domain-binding protein 4 (Gene Name=WBP4)

[Back to BioLiP]