Structure of PDB 8qpe Chain X Binding Site BS01

Receptor Information
>8qpe Chain X (length=80) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSL
DKAKEEEKASKEFAAMEAAALKAYQEDLKR
Ligand information
>8qpe Chain 6 (length=43) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acgauacagagaagauuagcauggccccugcgcaaggaugaca
...........................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qpe Structural insights into the cross-exon to cross-intron spliceosome switch
Resolution3.1 Å
Binding residue
(original residue number in PDB)		Y4 W5 K6 S7 Q8 N23
Binding residue
(residue number reindexed from 1)		Y2 W3 K4 S5 Q6 N21
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0046872 metal ion binding
GO:0070064 proline-rich region binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0016607 nuclear speck
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qpe, PDBe:8qpe, PDBj:8qpe
PDBsum8qpe
PubMed38778104
UniProtO75554|WBP4_HUMAN WW domain-binding protein 4 (Gene Name=WBP4)

[Back to BioLiP]