Structure of PDB 8g8g Chain X Binding Site BS01

Receptor Information
>8g8g Chain X (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEA
LQLSFKNMCKLRPLLQKWVEEADNNENLQEIRKRKRTSIENRVRGNLENL
FLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRS
Ligand information
>8g8g Chain I (length=174) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaagtatgtgtctttattcacaagcttgcacaatccctgctggacaattc
tgagtgatggcagctcccacctttccttctttcttcacttagactacatt
tattcagcatctgtattgttggagtaagttccatgttaatactcaccact
gaggatatgttaataccacttaac
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8g8g Histone modifications regulate pioneer transcription factor cooperativity.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		R157 T163 Q164 C185 R232 K233 R234 T235 I237 V273 V276 W277 N280
Binding residue
(residue number reindexed from 1)		R18 T24 Q25 C46 R84 K85 R86 T87 I89 V125 V128 W129 N132
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0031625 ubiquitin protein ligase binding
GO:0035198 miRNA binding
GO:0043565 sequence-specific DNA binding
GO:1990837 sequence-specific double-stranded DNA binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0001714 endodermal cell fate specification
GO:0001824 blastocyst development
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0009611 response to wounding
GO:0009653 anatomical structure morphogenesis
GO:0009786 regulation of asymmetric cell division
GO:0010468 regulation of gene expression
GO:0035019 somatic stem cell population maintenance
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:1902894 negative regulation of miRNA transcription
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8g8g, PDBe:8g8g, PDBj:8g8g
PDBsum8g8g
PubMed37225990
UniProtQ01860|PO5F1_HUMAN POU domain, class 5, transcription factor 1 (Gene Name=POU5F1)

[Back to BioLiP]