Structure of PDB 8g8b Chain X Binding Site BS01

Receptor Information
>8g8b Chain X (length=132) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEA
LQLSFKNMCKLRPLLQKWVEEADNNENLQEIENRVRGNLENLFLQCPKPT
LQQISHIAQQLGLEKDVVRVWFCNRRQKGKRS
Ligand information
>8g8b Chain I (length=168) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atgcacacatgctaatatatgcacacaatgcacacaggttaatatataca
catacacacacatgcacacacacgtgcacacatatatgcacatgcatgca
cacacgtatatgcacacacatgcacatgcatgcgcacatagtcacacaca
tgcacacattagcatatg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8g8b Histone modifications regulate pioneer transcription factor cooperativity.
Resolution4.3 Å
Binding residue
(original residue number in PDB)		F179 S180 T182 T183 N196
Binding residue
(residue number reindexed from 1)		F40 S41 T43 T44 N57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0031625 ubiquitin protein ligase binding
GO:0035198 miRNA binding
GO:0043565 sequence-specific DNA binding
GO:1990837 sequence-specific double-stranded DNA binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0001714 endodermal cell fate specification
GO:0001824 blastocyst development
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0009611 response to wounding
GO:0009653 anatomical structure morphogenesis
GO:0009786 regulation of asymmetric cell division
GO:0010468 regulation of gene expression
GO:0035019 somatic stem cell population maintenance
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:1902894 negative regulation of miRNA transcription
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8g8b, PDBe:8g8b, PDBj:8g8b
PDBsum8g8b
PubMed37225990
UniProtQ01860|PO5F1_HUMAN POU domain, class 5, transcription factor 1 (Gene Name=POU5F1)

[Back to BioLiP]