Structure of PDB 8g87 Chain X Binding Site BS01

Receptor Information
>8g87 Chain X (length=132) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEA
LQLSFKNMCKLRPLLQKWVEEADNNENLQEIENRVRGNLENLFLQCPKPT
LQQISHIAQQLGLEKDVVRVWFCNRRQKGKRS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8g87 Histone modifications regulate pioneer transcription factor cooperativity.
Resolution8.1 Å
Binding residue
(original residue number in PDB)
F179 S180 T182 T183 N196 K286
Binding residue
(residue number reindexed from 1)
F40 S41 T43 T44 N57 K130
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0031625 ubiquitin protein ligase binding
GO:0035198 miRNA binding
GO:0043565 sequence-specific DNA binding
GO:1990837 sequence-specific double-stranded DNA binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0001714 endodermal cell fate specification
GO:0001824 blastocyst development
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0009611 response to wounding
GO:0009653 anatomical structure morphogenesis
GO:0009786 regulation of asymmetric cell division
GO:0010468 regulation of gene expression
GO:0035019 somatic stem cell population maintenance
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:1902894 negative regulation of miRNA transcription
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8g87, PDBe:8g87, PDBj:8g87
PDBsum8g87
PubMed37225990
UniProtQ01860|PO5F1_HUMAN POU domain, class 5, transcription factor 1 (Gene Name=POU5F1)

[Back to BioLiP]