Structure of PDB 8b4b Chain X Binding Site BS01

Receptor Information
>8b4b Chain X (length=104) Species: 666 (Vibrio cholerae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKFILAEKFTFDPLSNTLIDKEDSEEIIRLGSNESRILWLLAQRPNEVIS
RNDLHDFVWRDDSSLTQAISTLRKMLKDSTKSPQYVKTVPKRGYQLIARV
ETVE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8b4b ToxR activates the Vibrio cholerae virulence genes by tethering DNA to the membrane through versatile binding to multiple sites.
Resolution1.75 Å
Binding residue
(original residue number in PDB)		T77 S81 T99 P101 K102 Y105
Binding residue
(residue number reindexed from 1)		T66 S70 T88 P90 K91 Y94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8b4b, PDBe:8b4b, PDBj:8b4b
PDBsum8b4b
PubMed37428913
UniProtP15795|TOXR_VIBCH Cholera toxin transcriptional activator (Gene Name=toxR)

[Back to BioLiP]