Structure of PDB 7w59 Chain X Binding Site BS01

Receptor Information
>7w59 Chain X (length=69) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LYERLQEQKDRKQQEYEEQFKFKNMVRGLDEDETNFLDEVSRQQELIEKQ
RREEELKELKEYRNNLKKV
Ligand information
>7w59 Chain G (length=82) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guaagagccuagcauguagaacugguuaccuccaggguuuccuugaugau
gucauacuuauccuguacagcucgcgguugag
..................................................
................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7w59 Mechanism of exon ligation by human spliceosome.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		Q66 E70
Binding residue
(residue number reindexed from 1)		Q13 E17
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0032091 negative regulation of protein binding
GO:1901799 negative regulation of proteasomal protein catabolic process
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7w59, PDBe:7w59, PDBj:7w59
PDBsum7w59
PubMed35705093
UniProtQ9GZU8|PIP30_HUMAN PSME3-interacting protein (Gene Name=PSME3IP1)

[Back to BioLiP]