Structure of PDB 7qtt Chain X Binding Site BS01

Receptor Information
>7qtt Chain X (length=241) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DEEELNDYKLRKRKTFEDNIRKNRTVISNWIKYAQWEESLKEIQRARSIY
ERALDVDYRNITLWLKYAEMEMKNRQVNHARNIWDRAITTLPRVNQFWYK
YTYMEEMLGNVAGARQVFERWMEWQPEEQAWHSYINFELRYKEVDRARTI
YERFVLVHPDVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHL
YVAFAKFEENQKEFERVRVIYKYALDRAQELFKNYTIFEKK
Ligand information
>7qtt Chain d (length=93) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugcucgcuucggcagcacauauacuaaaauuggaacgauacagagaaga
uuagcauggccccugcgcaaggaugacacgcucgugaagcguu
<<<<<.<<<..>>>>>>>>...............................
......<<...<<<.....>>>....>>...............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qtt Structural basis of catalytic activation in human splicing.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		R236 Y318 Q344 H347 S348
Binding residue
(residue number reindexed from 1)		R21 Y103 Q129 H132 S133
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006396 RNA processing
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0016607 nuclear speck
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:0071014 post-mRNA release spliceosomal complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qtt, PDBe:7qtt, PDBj:7qtt
PDBsum7qtt
PubMed37165190
UniProtQ9BZJ0|CRNL1_HUMAN Crooked neck-like protein 1 (Gene Name=CRNKL1)

[Back to BioLiP]