Structure of PDB 6uke Chain X Binding Site BS01

Receptor Information
>6uke Chain X (length=258) Species: 735 (Haemophilus parahaemolyticus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNWKEFEVFCVTYLNKTYGNKFAKKGESDSTTSDILFTGNNPFYIEAKMP
HSQCGQFVLIPNRAEYKFDYSPKNKSEINPYTQKIMQFMSENFSEYANLS
TKGKIIPLPESVFVNWIKEYYKSKSVKFFITSNGDFIIFPIEHFEHYFNV
SCTYRIKKSGSRHLNSKSLPDFKQALDKKGISYTMRGLELHSDENIHDKR
ISGDDKDFLIKENNGAYHVKILSNTFNANVIFSISLKNNISLFILNEDRK
AFEAAISL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6uke Structure of HhaI endonuclease with cognate DNA at an atomic resolution of 1.0 angstrom.
Resolution1.62 Å
Binding residue
(original residue number in PDB)		N2 W3 T32 E46 K48 M49 H51 S52 Q53 Q56 F57 V58 S71 K73 N74 K75 Y120 K157 S159 G160 R162 N165 K167 T225 N227
Binding residue
(residue number reindexed from 1)		N2 W3 T32 E46 K48 M49 H51 S52 Q53 Q56 F57 V58 S71 K73 N74 K75 Y120 K157 S159 G160 R162 N165 K167 T225 N227
External links