Structure of PDB 6qw6 Chain X Binding Site BS01

Receptor Information
>6qw6 Chain X (length=49) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IEMMKLMASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNRPL
Ligand information
>6qw6 Chain 4 (length=125) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcuuugcgcaguggcaguaucguagccaaugagguuuauccgaggcgcg
auuugcuaauugaaaacuucccaauagccgugacgacuagucggcauugg
caauuuuugacagucucgagacugg
...................<<<<<.<<<.....<<.....>>..>>>>>>
>>........................<<<<<<.<<<<..>>>>.>>>.>>
>.........<<<<<<..>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qw6 Mechanism of 5' splice site transfer for human spliceosome activation.
Resolution2.92 Å
Binding residue
(original residue number in PDB)		S114 T115 K116 G117 K119 V124
Binding residue
(residue number reindexed from 1)		S12 T13 K14 G15 K17 V22
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008150 biological_process
GO:0008380 RNA splicing
Cellular Component
GO:0005575 cellular_component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0046540 U4/U6 x U5 tri-snRNP complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6qw6, PDBe:6qw6, PDBj:6qw6
PDBsum6qw6
PubMed30975767
UniProtQ8WVK2|SNR27_HUMAN U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein (Gene Name=SNRNP27)

[Back to BioLiP]