Structure of PDB 6kkb Chain X Binding Site BS01

Receptor Information
>6kkb Chain X (length=243) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPEPTDEEWELIKTVTEAHVATNAQGSHWKQKRKFLPEDIGQAPIKVDLE
AFSHFTKIITPAITRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRA
AVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSLSSFNLDD
TEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHF
WPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kkb Revealing a Mutant-Induced Receptor Allosteric Mechanism for the Thyroid Hormone Resistance.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		K288 E299 I302 K306 L454 E457
Binding residue
(residue number reindexed from 1)		K71 E82 I85 K89 L237 E240
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6kkb, PDBe:6kkb, PDBj:6kkb
PDBsum6kkb
PubMed31655060
UniProtP10828|THB_HUMAN Thyroid hormone receptor beta (Gene Name=THRB)

[Back to BioLiP]