Structure of PDB 6hy2 Chain X Binding Site BS01

Receptor Information

>6hy2 Chain X (length=262) Species: 562 (Escherichia coli)

MIDKSAFVHPTAIVEEGASIGANAHIGPFCIVGPHVEIGEGTVLKSHVVV
NGHTKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHR
GTVQGGGLTKVGSDNLLMINAHIAHDCTVGNRCILANNATLAGHVSVDDF
AIIGGMTAVHQFCIIGAHVMVGGCSGVAQDVPPYVIAQGNHATPFGVNIE
GLKRRGFSREAITAIRNAYKLIYRSGKTLDEVKPEIAELAETYPEVKAFT
DFFARSTRGLIR

Ligand information

>6hy2 Chain A (length=12) Species: 562 (Escherichia coli)

WMLDPIAGKWSR

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6hy2 Structure guided design of an antibacterial peptide that targets UDP-N-acetylglucosamine acyltransferase.
• Resolution: 1.6 Å
• Binding residue (original residue number in PDB): A136 G155 M170 G172 G173 E200 R204
• Binding residue (residue number reindexed from 1): A136 G155 M170 G172 G173 E200 R204

Enzymatic activity

• Catalytic site (original residue number in PDB): H125 D126 G143
• Catalytic site (residue number reindexed from 1): H125 D126 G143
• Enzyme Commision number: 2.3.1.129: acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase.

Gene Ontology

Molecular Function

• GO:0008780 acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase activity
• GO:0016740 transferase activity
• GO:0016746 acyltransferase activity
• GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
• GO:0042802 identical protein binding

Biological Process

• GO:0008610 lipid biosynthetic process
• GO:0009245 lipid A biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:6hy2, PDBe:6hy2, PDBj:6hy2
• PDBsum: 6hy2
• PubMed: 30850651
• UniProt: P0A722|LPXA_ECOLI Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (Gene Name=lpxA)