Structure of PDB 6hmz Chain X Binding Site BS01

Receptor Information
>6hmz Chain X (length=170) Species: 3708 (Brassica napus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ANPKVFFDILIGKMKAGRVVMELFADVTPRTADNFRALCTGEKGIGQAGK
ALHYKGSAFHRIIPGFMCQGGDFTRGNGTGGESIYGAKFQDENFKLKHTG
PGILSMANSGPNTNGSQFFICTDKTAWLDGKHVVFGKVVDGYNVVKAMEK
VGSERGVTSEPVVIEDCGEI
Ligand information
>6hmz Chain A (length=11) Species: 29910 (Tolypocladium inflatum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TPGLVLAALLV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6hmz Enzyme activity and structural features of three single-domain phloem cyclophilins from Brassica napus.
Resolution1.98 Å
Binding residue
(original residue number in PDB)		R62 F67 Q70 G79 A108 N109 S110 Q118 F120 W128 L129 H133
Binding residue
(residue number reindexed from 1)		R61 F66 Q69 G78 A107 N108 S109 Q117 F119 W127 L128 H132
Enzymatic activity
Catalytic site (original residue number in PDB) R62 F67 Q70 N109 F120 L129 H133
Catalytic site (residue number reindexed from 1) R61 F66 Q69 N108 F119 L128 H132
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Gene Ontology
Molecular Function
GO:0003755 peptidyl-prolyl cis-trans isomerase activity
GO:0016018 cyclosporin A binding
GO:0046872 metal ion binding
Biological Process
GO:0000413 protein peptidyl-prolyl isomerization
GO:0006457 protein folding
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6hmz, PDBe:6hmz, PDBj:6hmz
PDBsum6hmz
PubMed31249367
UniProtA0A078GRH6

[Back to BioLiP]