Structure of PDB 6fy3 Chain X Binding Site BS01

Receptor Information
>6fy3 Chain X (length=178) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVQSGAEVKKPGESLKISCKGFGYSFSTYWIAWVRQMPGKGLEWMGM
IYPGDSDTKYSPSLQGQVTISGDKSISTAYLQWSSLKASDTAMYYCARLL
NNYDSSGFLYWYLDLWGRGTLVTVSSASTKGPSGCLVKDYFPEPFPAVLQ
SSGLYSLSSVCNVNHKPSNTKVDKKVEP
Ligand information
>6fy3 Chain Z (length=16) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LRDKKQKAYALFYRPD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fy3 Common helical V1V2 conformations of HIV-1 Envelope expose the alpha 4 beta 7 binding site on intact virions.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		W33 M50 Y52 D56 K58 L95 F100D L100E Y100F W100G
Binding residue
(residue number reindexed from 1)		W33 M50 Y52 D57 K59 L99 F108 L109 Y110 W111
External links