Structure of PDB 5wsg Chain X Binding Site BS01

Receptor Information

>5wsg Chain X (length=81) Species: 559292 (Saccharomyces cerevisiae S288C)

TLYVSQLNEKINMQRLRVNLFLLFATFGEVVSMNFKKQRGQAFITMRTID
QASLAQISLNGERFFGKPLKVEFSKSETKTL

Ligand information

>5wsg Chain L (length=91)

acgaaucucuuugccuuuuggcuuagaucaaguguaguaucuguucuuuu
caacauuuuuuggcaccgcgacccucgcacuuguggagucg

..................................................
................<<...<<...........>>...>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5wsg Structure of a yeast step II catalytically activated spliceosome
• Resolution: 4.0 Å
• Binding residue (original residue number in PDB): Y31 Q34 K38 V61 S62 M63 N64 K67 R69 Q71 F73 K97 S104 K105 S106 E107 T108 K109
• Binding residue (residue number reindexed from 1): Y3 Q6 K10 V31 S32 M33 N34 K37 R39 Q41 F43 K67 S74 K75 S76 E77 T78 K79

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0030620 U2 snRNA binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:1903241 U2-type prespliceosome assembly

Cellular Component

• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005686 U2 snRNP
• GO:0071004 U2-type prespliceosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5wsg, PDBe:5wsg, PDBj:5wsg
• PDBsum: 5wsg
• PubMed: 27980089
• UniProt: P40567|MSL1_YEAST U2 small nuclear ribonucleoprotein B'' (Gene Name=MSL1)